Page scores

Page Score
Paralink Translator : Free Translation, Dictionary, Text To Speech (Landing page)
Paralink Translator : Free Translation, Dictionary, Text To Speech
Paralink Translator : Free Translation, Dictionary, Text To Speech

Website thumbnail is a website with Italian content. Below is an analysis of the content on Optimize so that you rank better in Google for your chosen keywords.
This page was last updated 2015-12-25

SEO Camel Score: 57/100

SEO Keywords Analysis

Content language
Italian (it)
Content analysis
(Web of trust)
Good site
Content sample
translation Spanish TranslationFrench TranslationEnglish TranslationItalian TranslationRussian TranslationPortuguese Translation dictionary English to SpanishSpanish to EnglishEnglish to FrenchFrench to EnglishEnglish to GermanGerman to EnglishEnglish to ItalianItalian to EnglishEnglish to PortuguesePortuguese to EnglishEnglish to RussianRussian to EnglishEnglish to SpanishSpanish to EnglishEnglish to Serbian (lat)Serbian (lat) to EnglishFrench to GermanGerman to FrenchFrench to ItalianItalian to French download Extension for ChromeAdd-on for FirefoxPlugin for IETranslator WidgetTTS Widget interface EnglishArabic - العربيةChinese - 中文Czech - ČeštinaDanish - DanskDutch - NederlandsFrench - FrançaisGerman - DeutschGreek - ΕλληνικάHebrew - עבריתHindi - हिंदीItalian - ItalianoJapanese - 日本語Korean - 한국어Lithuanian - LietuviųPolish - PolskiPortuguese - PortuguêsRomanian - RomânăRussian - РусскийSpanish
Recurring phrases
online translation3
tts voice3
just released translation for:3
a u t o3
to spanishspanish to englishenglish to2
afrikaansalbanianarabicbelarusianbulgariancatalanchinese (simp.)chinese (trad.)croatianczechdanishdutchenglishestonianfilipinofinnishfrenchgaliciangermangreekhebrewhindihungarianicelandicindonesianirishitalianjapanesekoreanlatvianlithuanianmacedonianmalaymaltesenorwegianpersianpolishportugueseromanianrussianserbianslovakslovenianspanishswahiliswedishthaiturkishukrainianvietnamesewelshyiddish2
languages. total language directions:2
dictionarytext to speechimtranslator extensionswebmaster toolsonline blogonline store2
Keyword cloud
voice translate languages. speech: text translation englishenglish online language released
Keyword consistency
Keyword Freq Title Keywords Description Headings

Meta tags

Paralink Translator : Free Translation, Dictionary, Text To Speech

Length: 66

Perfect, your title contains between 10 and 70 characters.
Meta Description
Free online multilingual translation software for English, French, Spanish, German, Russian and Portuguese languages.

Length: 117

Great, your meta description contains between 70 and 160 characters.
Meta Keywords
Spanish translation, free Spanish translation, spanish translator, free online translation, multilingual translation, translation software, language translation software, spanish dictionary, spanish english dictionary, french translation, french translator

Length: 256

Good, your page contains meta keywords.
Og Meta Properties
This page does not take advantage of Og Properties. These tags allow social crawler's better structurize your page.

SEO content

H1 H2 H3 H4 H5 H6
0 0 0 0 0 0

323 images found

295 alt attributes are empty or missing. Add alternative text so that search engines can better understand the content of your images.
Text/HTML Ratio

This page's ratio of text to HTML code is below 15 percent, this means that your website probably needs more text content.
Perfect, no Flash content has been detected on this page.
Too Bad, you have Iframes on the web pages, this mean that content in an Iframe cannot be indexed.
URL Rewrite
Good. Your links looks friendly!
Underscores in the URLs
Perfect! No underscores detected in your URLs.
Link juice per link
2.9 %

This page has 35 outbound links. Therefore, each link is giving 2.9 % of the link juice to the target page.
On-page links
Filter links
Click here to show all links (35)


Domain :
Length : 12
Great, your website has a favicon.
We could not find a Print-Friendly CSS.
Good. Your declared language is en-us.
Dublin Core
This page does not take advantage of Dublin Core.


HTML 4.01 Strict
Perfect. Your declared charset is UTF-8.
Email privacy
Great no email address has been found in plain text!
Deprecated HTML
Deprecated HTML tags are HTML tags that are no longer used. It is recommended that you remove or replace these HTML tags because they are now obsolete.
u 1
font 3
The website does not encrypt data when communicating with the server.
Speed tips
Nested table Result Attention! Try to avoid nested tables in HTML.
Inline css Result Perfect. No inline css has been found in HTML tags!
CSS count Result Great, your website has few CSS files.
JS count Results Too bad, your website has too many JS files (more than 6).


FactorScoreLast check
Pagerank 5 / 102016-03-08
FactorRankingLast check
Alexa global rank 49000 2016-03-08
Alexa country rank Rank : 1823
Country : Saudi Arabia
Social shares
SourceViralityLast check
Google-plus shares 22 2016-03-08
Twitter shares n.a. 2016-03-08
Facebook Total_count : 582
Share_count : 204
Like_count : 256
Comment_count : 122
Commentsbox_count : 0
Click_count : 0
Pinterest shares 0 2016-03-08
Linkedin shares 0 2016-03-08
Xing Shares : 0
Comments : 0
Clicks : 0
Reach : 0
Delicious shares n.a. 2016-03-08
Digg shares n.a. 2016-03-08
Stumpleupon shares 1 2016-03-08


HTTP/1.1 200 OK
Connection: close
Date: Sat, 26 Dec 2015 01:11:48 GMT
Server: Microsoft-IIS/6.0
X-Powered-By: ASP.NET
Content-Length: 180089
Content-Type: text/html
Set-Cookie: CLRT=%23663300; path=/
Set-Cookie: CLR=%23A15101; path=/
Set-Cookie: sh=3; path=/
Cache-control: private
Who own's the website (WHOIS)
Registrar URL:
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
DNSSEC: unsigned

For complete domain details go to:

The data contained in, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy.  This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of, LLC.  By submitting an inquiry,
you agree to these terms of usage and limitations of warranty.  In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam.  You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes. 

Please note: the registrant of the domain name is specified
in the "registrant" section.  In most cases,, LLC 
is not the registrant of domain names listed in this database.